General Information

  • ID:  hor005695
  • Uniprot ID:  Q96A98
  • Protein name:  Tuberoinfundibular peptide of 39 residues
  • Gene name:  PTH2
  • Organism:  Homo sapiens (Human)
  • Family:  Parathyroid hormone family
  • Source:  Human
  • Expression:  Highly expressed in fetal and adult brain, cerebellum and trachea. Weakly expressed in spinal cord, fetal liver, kidney and heart.
  • Disease:  Diseases associated with PTH2 include Polyomavirus-Associated Nephropathy and Benign Chronic Pemphigus.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
  • Length:  39
  • Propeptide:  METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
  • Signal peptide:  METRQVSRSPRVRLLLLLLLLLVVPWGVRT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits.potentiate aspects of nociception within the spinal cord
  • Mechanism:  Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation.
  • Cross BBB:  NA
  • Target:  PTH2R
  • Target Unid:  P49190
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q96A98-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005695_AF2.pdbhor005695_ESM.pdb

Physical Information

Mass: 518226 Formula: C202H325N61O54S
Absent amino acids: CGIQT Common amino acids: L
pI: 9.3 Basic residues: 8
Polar residues: 4 Hydrophobic residues: 20
Hydrophobicity: -4.36 Boman Index: -7237
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 117.95
Instability Index: 6417.44 Extinction Coefficient cystines: 6990
Absorbance 280nm: 183.95

Literature

  • PubMed ID:  12559132
  • Title:  Tuberoinfundibular Peptide of 39 Residues (TIP39): Molecular Structure and Activity for Parathyroid Hormone 2 Receptor.
  • PubMed ID:  11861531
  • Title:  Anatomical and Physiological Evidence for Involvement of Tuberoinfundibular Peptide of 39 Residues in Nociception.
  • PubMed ID:  12098667
  • Title:  Characterization of the Human and Mouse Genes Encoding the Tuberoinfundibular Peptide of 39 Residues, a Ligand of the Parathyroid Hormone Receptor Family