General Information

  • ID:  hor005687
  • Uniprot ID:  E2E4L2
  • Protein name:  Goannatyrotoxin-Vere1
  • Gene name:  NA
  • Organism:  Varanus eremius (Rusty desert monitor)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Expressed by the mandibular venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Varanus (genus), Varanidae (family), Varanoidea (superfamily), Paleoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPTKPESPGPDATPEELAEYMTKIRQYINLVTRQRY
  • Length:  36(29-64)
  • Propeptide:  MIASMKPWPLVMVAALCILFCLGTLVDAYPTKPESPGPDATPEELAEYMTKIRQYINLVTRQRYGKRSSPETLMSELIFGENSNSDHSSRSRFDDSYMW
  • Signal peptide:  MIASMKPWPLVMVAALCILFCLGTLVDA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Shows a potent unique triphasic action, rapid biphasic hypertension followed by prolonged hypotension
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E2E4L2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005687_AF2.pdbhor005687_ESM.pdb

Physical Information

Mass: 488124 Formula: C190H296N50O59S
Absent amino acids: CFHW Common amino acids: P
pI: 6.67 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -111.67 Boman Index: -9315
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 56.94
Instability Index: 5842.78 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  20631207
  • Title:  Functional and structural diversification of the Anguimorpha lizard venom system.