General Information

  • ID:  hor005682
  • Uniprot ID:  P28674
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  npy
  • Organism:  Torpedo marmorata (Marbled electric ray)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Torpedo (genus), Torpedinidae (family), Torpediniformes (order), Batoidea (superorder), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SSPEALMMTDLMLRENAESFPKYRYDEPFMW
  • Length:  31(68-98)
  • Propeptide:  MQTNMKFWLGVFTFAFCMLICIGTFADAYPSKPDNPGEGAPAEDLAKYYSALRHYINLITRQRYGKRSSPEALMMTDLMLRENAESFPKYRYDEPFMW
  • Signal peptide:  MQTNMKFWLGVFTFAFCMLICIGTFADA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P28674-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005682_AF2.pdbhor005682_ESM.pdb

Physical Information

Mass: 432158 Formula: C169H250N40O51S4
Absent amino acids: CGHIQV Common amino acids: EM
pI: 4.1 Basic residues: 3
Polar residues: 7 Hydrophobic residues: 8
Hydrophobicity: -66.45 Boman Index: -6369
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 44.19
Instability Index: 6462.9 Extinction Coefficient cystines: 8480
Absorbance 280nm: 282.67

Literature

  • PubMed ID:  1549597
  • Title:  Strong evolutionary conservation of neuropeptide Y: sequences of chicken, goldfish, and Torpedo marmorata DNA clones.