General Information

  • ID:  hor005679
  • Uniprot ID:  Q9PT98
  • Protein name:  Peptide Y
  • Gene name:  NA
  • Organism:  Dicentrarchus labrax (European seabass) (Morone labrax)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Dicentrarchus (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPPKPESPGSNASPEDWAKYHAAVRHYVNLITRQRY
  • Length:  36(29-64)
  • Propeptide:  MANMLRSWMMLAALAVCLLVCLSSFADAYPPKPESPGSNASPEDWAKYHAAVRHYVNLITRQRYGKRSTPEQAVAWLLFGADSSQDAEPRLDYSDQW
  • Signal peptide:  MANMLRSWMMLAALAVCLLVCLSSFADA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PT98-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005679_AF2.pdbhor005679_ESM.pdb

Physical Information

Mass: 482410 Formula: C190H281N55O54
Absent amino acids: CFM Common amino acids: P
pI: 9.6 Basic residues: 7
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -117.78 Boman Index: -9124
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 48.89
Instability Index: 8123.61 Extinction Coefficient cystines: 11460
Absorbance 280nm: 327.43

Literature

  • PubMed ID:  9629200
  • Title:  Cloning of neuropeptide Y, peptide YY, and peptide Y from sea bass (Dicentrarchus labrax), a marine teleost.