HORDB

ID: hor005672
Uniprot ID: Q9PW68
Protein name: C-flanking peptide of NPY
Gene name: npy
Organism: Typhlonectes natans (Rubber eel)
Family: NPY family
Source: Animal
Expression: Expressed throughout the brain with highest levels of expression in medial pallium, basal forebrain, preoptic area, midbrain tegmentum and trigeminal nucleus.
Disease: NA
Comments: NA
Taxonomy: Typhlonectes (genus), Typhlonectidae (family), Gymnophiona (order), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: SNPETMVSDVWWRESTENIPRSRFEDPSMW
Length: 30(68-97)
Propeptide: MQGSMRLWLSVLTFTLSLLICLGTLADAYPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRYGKRSNPETMVSDVWWRESTENIPRSRFEDPSMW
Signal peptide: MQGSMRLWLSVLTFTLSLLICLGTLADA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005672_AF2.pdb

hor005672_ESM.pdb

Mass:	418740	Formula:	C160H234N44O52S2
Absent amino acids:	ACGHKLQY	Common amino acids:	S
pI:	4.1	Basic residues:	3
Polar residues:	9	Hydrophobic residues:	7
Hydrophobicity:	-116.33	Boman Index:	-9719
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	32.33
Instability Index:	7242	Extinction Coefficient cystines:	16500
Absorbance 280nm:	568.97