General Information

  • ID:  hor005655
  • Uniprot ID:  P01298
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Homo sapiens (Human)
  • Family:  NPY family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with PPY include Non-Functioning Pancreatic Endocrine Tumor and Auditory System Cancer.
  • Comments:  Obinepitide is under clinical trial by 7TM Pharma to be used for the treatment of obesity. Obinepitide is derived from pancreatic hormone by having Gln-63
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0009306 protein secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
  • Length:  36(30-65)
  • Propeptide:  MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
  • Signal peptide:  MAAARLCLSLLLLSTCVALLLQPLLGAQG
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01298-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005655_AF2.pdbhor005655_ESM.pdb

Physical Information

Mass: 480721 Formula: C185H286N52O55S2
Absent amino acids: CFHKSW Common amino acids: AP
pI: 6.6 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 10
Hydrophobicity: -78.06 Boman Index: -8239
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 65.28
Instability Index: 6316.39 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  6094571
  • Title:  Structure of a Precursor to Human Pancreatic Polypeptide