General Information

  • ID:  hor005646
  • Uniprot ID:  E2A6Z3
  • Protein name:  Peptide LRSQLDIGDLQ
  • Gene name:  EAG_07220
  • Organism:  Camponotus floridanus (Florida carpenter ant)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Camponotus (genus), Camponotini (tribe), Formicinae (subfamily), Formicidae (family), Formicoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LRSQLDIGDLQ
  • Length:  11(64-74)
  • Propeptide:  MSSVRNIAALALVLLVLAEWSAAMPTTDKDKERLLNTVDLIDDDGSIETALINYLFTKQIVKRLRSQLDIGDLQRKRSYWKQCAFNAVSCFGK
  • Signal peptide:  MSSVRNIAALALVLLVLAEWSAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits juvenile hormone biosynthesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E2A6Z3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005646_AF2.pdbhor005646_ESM.pdb

Physical Information

Mass: 143598 Formula: C53H92N16O19
Absent amino acids: ACEFHKMNPTVWY Common amino acids: L
pI: 4.11 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -34.55 Boman Index: -2622
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 141.82
Instability Index: 11369.09 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  25641051
  • Title:  Neuropeptidomics of the carpenter ant Camponotus floridanus.