General Information

  • ID:  hor005611
  • Uniprot ID:  V9QEI7
  • Protein name:  Alpha-latrotoxin associated low molecular weight protein 2
  • Gene name:  NA
  • Organism:  Latrodectus hesperus (Western black widow spider)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Latrodectus (genus), Theridiidae (family), Araneoidea (superfamily), Orbiculariae, Entelegynae, Araneomorphae (suborder), Araneae (order), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EDSLDPAEYGCADDINQEDLLKKNDVCLQCEDLHKEGVVFSLCKTNCFTTQYFTNCVKDLEEAEKEPPE
  • Length:  69(20-88)
  • Propeptide:  MLKLICIAFLVTVLTLVAGEDSLDPAEYGCADDINQEDLLKKNDVCLQCEDLHKEGVVFSLCKTNCFTTQYFTNCVKDLEEAEKEPPE
  • Signal peptide:  MLKLICIAFLVTVLTLVAG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May increase the toxicity of alpha-latrotoxin and/or other venom components. Is non-toxic to mice and to the cockroach Periplaneta americana
  • Mechanism:  Co-purifies with latroinsectotoxin.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  11-47; 27-43; 30-56
  • Structure ID:  AF-P49125-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005611_AF2.pdbhor005611_ESM.pdb

Physical Information

Mass: 907579 Formula: C336H518N84O121S6
Absent amino acids: MRW Common amino acids: E
pI: 3.85 Basic residues: 7
Polar residues: 20 Hydrophobic residues: 18
Hydrophobicity: -72.46 Boman Index: -15691
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 66.38
Instability Index: 3561.3 Extinction Coefficient cystines: 3355
Absorbance 280nm: 49.34

Literature

  • PubMed ID:  24316130
  • Title:  Recruitment and diversification of an ecdysozoan family of neuropeptide hormones for black widow spider venom expression.