General Information

  • ID:  hor005589
  • Uniprot ID:  O73811
  • Protein name:  GnRH-associated peptide 2
  • Gene name:  gnrh2
  • Organism:  Morone saxatilis (Striped bass) (Perca saxatilis)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Morone (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ELDSFGTSEISEEIKLCEAGECSYLRPQRRNVLRNIILDALARELQKRK
  • Length:  49(37-85)
  • Propeptide:  MCVSRLVLLFGLLLCVGAQLSNAQHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRNVLRNIILDALARELQKRK
  • Signal peptide:  MCVSRLVLLFGLLLCVGAQLSNA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P82951-F1(AlphaFold_DB_ID)/1S6W(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1s6w.pdbhor005589_AF2.pdbhor005589_ESM.pdb

Physical Information

Mass: 654886 Formula: C244H410N74O78S2
Absent amino acids: HMW Common amino acids: EL
pI: 6.54 Basic residues: 9
Polar residues: 12 Hydrophobic residues: 16
Hydrophobicity: -60.82 Boman Index: -14094
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 99.59
Instability Index: 9698.57 Extinction Coefficient cystines: 1615
Absorbance 280nm: 33.65

Literature

  • PubMed ID:  9845669
  • Title:  Multiple GnRHs present in a teleost species are encoded by separate genes: analysis of the sbGnRH and cGnRH-II genes from the striped bass, Morone saxatilis.