General Information

  • ID:  hor005587
  • Uniprot ID:  P82951
  • Protein name:  Hepcidin
  • Gene name:  hamp
  • Organism:  Morone chrysops x Morone saxatilis (White bass x Striped bass)
  • Family:  Hepcidin family
  • Source:  animal
  • Expression:  By bacterial challenge.|Predominantly expressed in liver.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Morone (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0042742 defense response to bacterium
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GCRFCCNCCPNMSGCGVCCRF
  • Length:  21
  • Propeptide:  MKTFSVAVAVAVVLAFICLQESSAVPVTEVQELEEPMSNEYQEMPVESWKMPYNNRHKRHSSPGGCRFCCNCCPNMSGCGVCCRF
  • Signal peptide:  MKTFSVAVAVAVVLAFICLQESSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages.Antimicrobial activity against Gram-negative bacteria such as E.coli.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-19; 5-8; 6-15; 9-18
  • Structure ID:  1s6w(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    1s6w.pdbhor005587_AF2.pdbhor005587_ESM.pdb

Physical Information

Mass: 262067 Formula: C86H135N29O25S9
Absent amino acids: ADEHIKLQTWY Common amino acids: C
pI: 7.97 Basic residues: 2
Polar residues: 14 Hydrophobic residues: 3
Hydrophobicity: 57.62 Boman Index: -2111
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 13.81
Instability Index: 3824.76 Extinction Coefficient cystines: 500
Absorbance 280nm: 25

Literature

  • PubMed ID:  11985602
  • Title:  Bass hepcidin is a novel antimicrobial peptide induced by bacterial challenge.
  • PubMed ID:  15546886
  • Title:  Bass hepcidin synthesis, solution structure, antimicrobial activities and synergism, and in vivo hepatic response to bacterial infections.