General Information

  • ID:  hor005581
  • Uniprot ID:  Q99MH3
  • Protein name:  Hepcidin
  • Gene name:  Hamp
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Hepcidin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005507 copper ion binding
  • GO BP:  GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0002262 myeloid cell homeostasis; GO:0006366 transcription by RNA polymerase II; GO:0006879 intracellular iron ion homeostasis; GO:0006953 acute-phase response; GO:0006954 inflammatory response; GO:0007259 receptor signaling pathway via JAK-STAT; GO:0010039 response to iron ion; GO:0010043 response to zinc ion; GO:0030163 protein catabolic process; GO:0033189 response to vitamin A; GO:0034755 iron ion transmembrane transport; GO:0034760 negative regulation of iron ion transmembrane transport; GO:0036017 response to erythropoietin; GO:0042116 macrophage activation; GO:0042742 defense response to bacterium; GO:0043032 positive regulation of macrophage activation; GO:0045471 response to ethanol; GO:0045732 positive regulation of protein catabolic process; GO:0045779 negative regulation of bone resorption; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0050728 negative regulation of inflammatory response; GO:0050832 defense response to fungus; GO:0051649 establishment of localization in cell; GO:0060586 multicellular organismal-level iron ion homeostasis; GO:0061051 positive regulation of cell growth involved in cardiac muscle cell development; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0071222 cellular response to lipopolysaccharide; GO:0071354 cellular response to interleukin-6; GO:0071356 cellular response to tumor necrosis factor; GO:0071481 cellular response to X-ray; GO:0097421 liver regeneration; GO:1903413 cellular response to bile acid; GO:1904479 negative regulation of intestinal absorption; GO:1990641 response to iron ion starvation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005634 nucleus; GO:0014704 intercalated disc; GO:0045179 apical cortex

Sequence Information

  • Sequence:  DTNFPICLFCCKCCKNSSCGLCCIT
  • Length:  25
  • Propeptide:  MALSTRIQAACLLLLLLASLSSGAYLRQQTRQTTALQPWHGAESKTDDSALLMLKRRKRDTNFPICLFCCKCCKNSSCGLCCIT
  • Signal peptide:  MALSTRIQAACLLLLLLASLSSG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. May also have antimicrobial activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-23; 10-13; 11-19; 14-22
  • Structure ID:  AF-P81172-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005581_AF2.pdbhor005581_ESM.pdb

Physical Information

Mass: 314859 Formula: C111H179N29O34S8
Absent amino acids: AEHMQRVWY Common amino acids: C
pI: 7.61 Basic residues: 2
Polar residues: 15 Hydrophobic residues: 6
Hydrophobicity: 75.6 Boman Index: -822
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 62.4
Instability Index: 2735.6 Extinction Coefficient cystines: 500
Absorbance 280nm: 20.83

Literature

  • PubMed ID:  11113132
  • Title:  A new mouse liver-specific gene, encoding a protein homologous to human antimicrobial peptide hepcidin, is overexpressed during iron overload