HORDB

General Information

ID: hor005578
Uniprot ID: P04155
Protein name: Trefoil factor 1
Gene name: TFF1
Organism: Homo sapiens (Human)
Family: NA
Source: Human
Expression: Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal g
Disease: Diseases associated with TFF1 include Gastric Ulcer and Bile Reflux.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005515 protein binding; GO:0008083 growth factor activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0008285 negative regulation of cell population proliferation; GO:0010039 response to iron ion; GO:0030154 cell differentiation; GO:0030277 maintenance of gastrointestinal epithelium; GO:0035902 response to immobilization stress; GO:0043434 response to peptide hormone
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Length: 60(25-84)
Propeptide: MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Signal peptide: MATMENKVICALVLVSMLALGTLA
Modification: NA
Glycosylation: NA
Mutagenesis: 58-58C->S: Abolishes inhibition of gastric cancer cell growth.

Activity

Function: Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: 7-33; 17-32; 27-44
Structure ID: AF-P58990-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005578_AF2.pdb

hor005578_ESM.pdb

Physical Information

Mass:	772693	Formula:	C285H425N77O95S7
Absent amino acids:	HLM	Common amino acids:	CEPT
pI:	3.92	Basic residues:	4
Polar residues:	22	Hydrophobic residues:	14
Hydrophobicity:	-56.33	Boman Index:	-12212
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	35.67
Instability Index:	6709.83	Extinction Coefficient cystines:	7365
Absorbance 280nm:	124.83

Literature

PubMed ID: 3146413
Title: Primary structure of human protein pS2.
PubMed ID: 15924415
Title: Interaction between TFF1, a gastric tumor suppressor trefoil protein, and TFIZ1, a Brichos domain-containing protein with homology to SP-C.
PubMed ID: 16308573
Title: Identification of human urinary trefoil factor 1 as a novel calcium oxala
PubMed ID: 3261981
Title:
PubMed ID: 15340161
Title: