General Information

  • ID:  hor005571
  • Uniprot ID:  P83627
  • Protein name:  Vitellogenesis-inhibiting hormone
  • Gene name:  NA
  • Organism:  Armadillidium vulgare (Pillbug) (Pill woodlouse)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Found in the sinus glands of both male and female. Found also in the brain; the neuroendocrine structures of the protocerebrum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Armadillidium (genus), Armadillidiidae (family), Crinocheta, Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE
  • Length:  83(1-83)
  • Propeptide:  YNIPLGWGRRDMPGCLGVLGNRDLYDDVSRICSDCQNVFRDKNVESKCRSDCFSTSYFETCIMALDLAEKISDYKLHASILKE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits secondary vitellogenesis in females. Has no hyperglycemic or molt-inhibiting activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  15-52; 32-48; 35-61
  • Structure ID:  AF-D2IT41-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-D2IT41-F1.pdbhor005571_AF2.pdbhor005571_ESM.pdb

Physical Information

Mass: 1095362 Formula: C410H644N114O129S8
Absent amino acids: Common amino acids: DLS
pI: 5.05 Basic residues: 12
Polar residues: 29 Hydrophobic residues: 24
Hydrophobicity: -35.54 Boman Index: -17875
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 78.67
Instability Index: 4015.18 Extinction Coefficient cystines: 11835
Absorbance 280nm: 144.33

Literature

  • PubMed ID:  10480992
  • Title:  Isolation and amino acid sequence of a peptide with vitellogenesis inhibiting activity from the terrestrial isopod Armadillidium vulgare (Crustacea).
  • PubMed ID:  12679090
  • Title:  Localization of crustacean hyperglycemic and vitellogenesis-inhibiting hormones in separate cell types i