General Information

  • ID:  hor005564
  • Uniprot ID:  P69109
  • Protein name:  Gonadoliberin-3
  • Gene name:  gnrh3
  • Organism:  Oncorhynchus nerka (Sockeye salmon) (Salmo nerka)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  Brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGWLPG
  • Length:  10(24-33)
  • Propeptide:  MDLSNRTVVQVVVLALVAQVTLSQHWSYGWLPGGKRSVGELEATIKMMDTGGVVALPEETSAHVSERLRPYDVILKKWMPHK
  • Signal peptide:  MDLSNRTVVQVVVLALVAQVTLS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P69107-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005564_AF2.pdbhor005564_ESM.pdb

Physical Information

Mass: 139106 Formula: C60H75N15O14
Absent amino acids: ACDEFIKMNRTV Common amino acids: GW
pI: 7.54 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -92 Boman Index: -228
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 39
Instability Index: 4157 Extinction Coefficient cystines: 12490
Absorbance 280nm: 1387.78

Literature

  • PubMed ID:  8674859
  • Title:  Characterization of the pacific salmon gonadotropin-releasing hormone gene, copy number and transcription start site.
  • PubMed ID:  8546809
  • Title:   Two differing precursor genes for the salmon-type gonadotropin-releasing hormone exist in salmonids.