General Information

  • ID:  hor005559
  • Uniprot ID:  Q8MJ80
  • Protein name:  Hepcidin
  • Gene name:  HAMP
  • Organism:  Sus scrofa (Pig)
  • Family:  Hepcidin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0010039 response to iron ion; GO:0034760 negative regulation of iron ion transmembrane transport; GO:0042742 defense response to bacterium; GO:0060586 multicellular organismal-level iron ion homeostasis; GO:1904479 negative regulation of intestinal absorption
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DTHFPICIFCCGCCRKAICGMCCKT
  • Length:  25(58-82)
  • Propeptide:  MALSVQIRAACLLLLLLVSLTAGSVLPSQTRQLTDLRTQDTAGATAGLTPVAQRLRRDTHFPICIFCCGCCRKAICGMCCKT
  • Signal peptide:  MALSVQIRAACLLLLLLVSLTAG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. May also have antimicrobial activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-23; 10-13; 11-19; 14-22
  • Structure ID:  AF-Q8MJ80-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005559_AF2.pdbhor005559_ESM.pdb

Physical Information

Mass: 318573 Formula: C113H182N32O30S9
Absent amino acids: ELNQSVWY Common amino acids: C
pI: 7.97 Basic residues: 4
Polar residues: 12 Hydrophobic residues: 6
Hydrophobicity: 80 Boman Index: -754
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 50.8
Instability Index: 714.4 Extinction Coefficient cystines: 500
Absorbance 280nm: 20.83

Literature

  • PubMed ID:  NA
  • Title:  NA