General Information

  • ID:  hor005558
  • Uniprot ID:  D2Z1D6
  • Protein name:  Pigment-dispersing hormone
  • Gene name:  PDH
  • Organism:  Armadillidium vulgare (Pillbug) (Pill woodlouse)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  Expressed strongly in the head and weakly in the ventral nerve cord. Not detected in the midgut cecum or hindgut. In the cephalic neural complex, specifically localized to cells within the optic lobe, anteromedian protocerebrum, accessory lobe, tritocereb
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Armadillidium (genus), Armadillidiidae (family), Crinocheta, Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  NSELINSLLGAPRVLNNA
  • Length:  18(63-80)
  • Propeptide:  MIGKYLSWFMLAFLFGFVLESYRVQSQDLNPTEKEVLSNMLDFLQRHSRTTYMFPLLSESKRNSELINSLLGAPRVLNNAGR
  • Signal peptide:  MIGKYLSWFMLAFLFGFVLESYRVQS
  • Modification:  T18 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neurom
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-D2Z1D6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005558_AF2.pdbhor005558_ESM.pdb

Physical Information

Mass: 219856 Formula: C81H139N25O27
Absent amino acids: CDFHKMQTWY Common amino acids: LN
pI: 6.41 Basic residues: 1
Polar residues: 7 Hydrophobic residues: 8
Hydrophobicity: 10.56 Boman Index: -2189
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 135.56
Instability Index: 2093.89 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20637211
  • Title:  Precursor structure, distribution and possible functions of pigment-dispersing hormone (PDH) in the terrestrial isopod Armadillidium vulgare (Latreille)