General Information

  • ID:  hor005555
  • Uniprot ID:  Q03191
  • Protein name:  Trefoil factor 3
  • Gene name:  Tff3
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NA
  • Source:  Animal
  • Expression:  Up-regulated by hypoxia in gastric epithelial cells. Up-regulated by hypoxia-inducible factor 1 alpha (HIF1A). |Expressed in goblet cells of the intestines, and colon, in paraventricular hypothalamus and supraoptic nuclei. Weakly expressed in gastric epit
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding; GO:0042802 identical protein binding
  • GO BP:  GO:0010906 regulation of glucose metabolic process; GO:0030277 maintenance of gastrointestinal epithelium; GO:0043434 response to peptide hormone
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0030141 secretory granule

Sequence Information

  • Sequence:  QEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
  • Length:  59(23-81)
  • Propeptide:  METRAFWTTLLLVLVAGSSCKAQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
  • Signal peptide:  METRAFWTTLLLVLVAGSSCKA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  11-37; 21-36; 31-48; 57-57
  • Structure ID:  AF-Q03191-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005555_AF2.pdbhor005555_ESM.pdb

Physical Information

Mass: 759912 Formula: C282H427N75O90S8
Absent amino acids: H Common amino acids: CPV
pI: 4.1 Basic residues: 3
Polar residues: 24 Hydrophobic residues: 15
Hydrophobicity: -20.34 Boman Index: -8702
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 51.02
Instability Index: 7108.81 Extinction Coefficient cystines: 7365
Absorbance 280nm: 126.98

Literature

  • PubMed ID:  1763017
  • Title:  Identification and characterization of rat intestinal trefoil factor: tissue- and cell-specific member of the trefoil protein family.
  • PubMed ID:  1439565
  • Title:  Molecular and cellular analysis of rP1.B in the rat hypothalamus: in situ hybridization and immunohistochemistry of a ne
  • PubMed ID:  1637322
  • Title:  
  • PubMed ID:  8454642
  • Title:  
  • PubMed ID:  19076725
  • Title: