General Information

  • ID:  hor005553
  • Uniprot ID:  P81191
  • Protein name:  Relaxin-like protein AGF B chain
  • Gene name:  NA
  • Organism:  Hypanus sabinus (Atlantic stingray) (Dasyatis sabina)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hypanus (genus), Dasyatidae (family), Dasyatoidea (superfamily), Myliobatiformes (order), Batoidea (superorder), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WPRGPDYTERRVMCGLQYVRAAISICGPNMQTMRPRNGSGPIVPPPDFLAMYGM
  • Length:  54(1-54)
  • Propeptide:  WPRGPDYTERRVMCGLQYVRAAISICGPNMQTMRPRNGSGPIVPPPDFLAMYGMARYKPPLSKKCCSTGCNREDFRGYCYL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T37 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Uncertain.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81191-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005553_AF2.pdbhor005553_ESM.pdb

Physical Information

Mass: 700162 Formula: C265H415N77O72S7
Absent amino acids: HK Common amino acids: P
pI: 9.32 Basic residues: 6
Polar residues: 17 Hydrophobic residues: 13
Hydrophobicity: -33.52 Boman Index: -8308
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 57.78
Instability Index: 3072.04 Extinction Coefficient cystines: 10095
Absorbance 280nm: 190.47

Literature

  • PubMed ID:  9271504
  • Title:  Identification of a glycosylated relaxin-like molecule from the male Atlantic stingray, Dasyatis sabina.