General Information

  • ID:  hor005544
  • Uniprot ID:  P68248
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Gallus gallus (Chicken)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY
  • Length:  36(26-61)
  • Propeptide:  MPPRWASLLLLACSLLLLAVPPGTAGPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRYGRRSSSRVLCEEPMGAAGC
  • Signal peptide:  MPPRWASLLLLACSLLLLAVPPGTA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68248-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005544_AF2.pdbhor005544_ESM.pdb

Physical Information

Mass: 486311 Formula: C190H282N52O59
Absent amino acids: CKMW Common amino acids: DPY
pI: 4.59 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -92.22 Boman Index: -9164
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 70.28
Instability Index: 6751.39 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  1194289
  • Title:  Structure determination and evolution of the chicken cDNA and gene encoding prepropancreatic polypeptide.