General Information

  • ID:  hor005538
  • Uniprot ID:  P55846
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Cancer pagurus (Rock crab)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cancer (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVINDDCPNLIGNRDLYKKVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE
  • Length:  78(1-78)
  • Propeptide:  RVINDDCPNLIGNRDLYKKVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Has also significant hyperglycemic hormone (CHH) activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-P55846-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P55846-F1.pdbhor005538_AF2.pdbhor005538_ESM.pdb

Physical Information

Mass: 1057412 Formula: C400H618N114O120S8
Absent amino acids: H Common amino acids: ENRCL
pI: 4.74 Basic residues: 10
Polar residues: 26 Hydrophobic residues: 25
Hydrophobicity: -41.67 Boman Index: -17558
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 73.72
Instability Index: 4287.31 Extinction Coefficient cystines: 19855
Absorbance 280nm: 257.86

Literature

  • PubMed ID:  8868306
  • Title:  Determination of the amino acid sequence of the moult-inhibiting hormone from the edible crab, Cancer pagurus.