General Information

  • ID:  hor005534
  • Uniprot ID:  Q06202
  • Protein name:  PDH precursor-related peptide
  • Gene name:  NA
  • Organism:  Carcinus maenas (Common shore crab) (Green crab)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  Expressed in eyestalk tissue and cerebral ganglia.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carcinus (genus), Carcinidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  QDLKYQEREMVAELAQQIYRVAQAPWAGAVGPH
  • Length:  33(23-55)
  • Propeptide:  MRSAVIVTMLVVVALAALLTQGQDLKYQEREMVAELAQQIYRVAQAPWAGAVGPHKRNSELINSILGLPKVMNDAGRR
  • Signal peptide:  MRSAVIVTMLVVVALAALLTQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neurom
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q06202-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005534_AF2.pdbhor005534_ESM.pdb

Physical Information

Mass: 432523 Formula: C167H258N48O49S
Absent amino acids: CFNST Common amino acids: A
pI: 5.62 Basic residues: 4
Polar residues: 4 Hydrophobic residues: 13
Hydrophobicity: -53.64 Boman Index: -5288
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 80
Instability Index: 1477.27 Extinction Coefficient cystines: 8480
Absorbance 280nm: 265

Literature

  • PubMed ID:  1282803
  • Title:  Molecular cloning of crustacean pigment dispersing hormone precursor.