General Information

  • ID:  hor005519
  • Uniprot ID:  P33528
  • Protein name:  Glucagon
  • Gene name:  gcg
  • Organism:  Amia calva (Bowfin)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Amia (genus), Amiidae (family), Amiiformes (order), Holostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSQGTFTNDYSKYMDTRRAQDFVQWLMST
  • Length:  29(1-29)
  • Propeptide:  HSQGTFTNDYSKYMDTRRAQDFVQWLMSTXXXXXXXXXXXXXXXYADAPYISDVYSYLQDQVAKKWLKSGQDRRE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005519_AF2.pdbhor005519_ESM.pdb

Physical Information

Mass: 401445 Formula: C153H225N43O49S2
Absent amino acids: CEIP Common amino acids: T
pI: 7.54 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: -105.17 Boman Index: -8553
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 26.9
Instability Index: 6561.03 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  8240302
  • Title:  Structure and biological activity of glucagon and glucagon-like peptide from a primitive bony fish, the bowfin (Amia calva).