General Information

  • ID:  hor005508
  • Uniprot ID:  P0CJ11
  • Protein name:  Venom protein 55.1
  • Gene name:  NA
  • Organism:  Lychas mucronatus (Chinese swimming scorpion)
  • Family:  Diuretic hormone class 2 family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lychas (genus), Buthidae (family), Buthoidea (superfamily), Buthida (parvorder), Scorpiones (order), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0008613 diuretic hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007589 body fluid secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TTSSMKRELDLGMSRGHSGSQVGKALLGIQSANRTDGP
  • Length:  38(20-57)
  • Propeptide:  MNFLCILFVVSLISSLSKCTTSSMKRELDLGMSRGHSGSQVGKALLGIQSANRTDGPGRKRRSFDLYALVNAK
  • Signal peptide:  MNFLCILFVVSLISSLSKC
  • Modification:  T38 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulates fluid secretion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0CJ11-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005508_AF2.pdbhor005508_ESM.pdb

Physical Information

Mass: 460455 Formula: C161H276N54O57S2
Absent amino acids: CFWY Common amino acids: GS
pI: 10.76 Basic residues: 6
Polar residues: 16 Hydrophobic residues: 8
Hydrophobicity: -66.05 Boman Index: -8800
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 64.21
Instability Index: 4572.63 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20663230
  • Title:  Comparative venom gland transcriptome analysis of the scorpion Lychas mucronatus reveals intraspecific toxic gene diversity and new venomous components.