General Information

  • ID:  hor005507
  • Uniprot ID:  P30814
  • Protein name:  Crustacean hyperglycemic hormone
  • Gene name:  NA
  • Organism:  Armadillidium vulgare (Pillbug) (Pill woodlouse)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Found also in the brain; in the neuroendocrine structures of the protocerebrum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Armadillidium (genus), Armadillidiidae (family), Crinocheta, Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RIFDTSCKGFYDRGLFAQLDRVCEDCYNLYRKPHVAAECRRDCYTTEVFESCLKDLMMHDFINEYKEMALMVS
  • Length:  73(1-73)
  • Propeptide:  RIFDTSCKGFYDRGLFAQLDRVCEDCYNLYRKPHVAAECRRDCYTTEVFESCLKDLMMHDFINEYKEMALMVS
  • Signal peptide:  NA
  • Modification:  T73 Serine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Control the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P30814-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P30814-F1.pdbhor005507_AF2.pdbhor005507_ESM.pdb

Physical Information

Mass: 1002048 Formula: C381H582N102O114S10
Absent amino acids: W Common amino acids: DCELR
pI: 5.06 Basic residues: 12
Polar residues: 21 Hydrophobic residues: 21
Hydrophobicity: -35.62 Boman Index: -16375
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 64.11
Instability Index: 4859.73 Extinction Coefficient cystines: 7825
Absorbance 280nm: 108.68

Literature

  • PubMed ID:  8436119
  • Title:  Isolation and molecular characterization of a hyperglycemic neuropeptide from the sinus gland of the terrestrial isopod Armadillidium vulgare (Crustacea).
  • PubMed ID:  12679090
  • Title:  Localization of crustacean hyperglycemic and vitellogenesis-inhibiting hormones in separate cell ty