General Information

  • ID:  hor005492
  • Uniprot ID:  O46166
  • Protein name:  U1-agatoxin-Ta1a
  • Gene name:  NA
  • Organism:  Eratigena agrestis (Hobo spider) (Tegenaria agrestis)
  • Family:  Helical arthropod-neuropeptide-derived (HAND) family
  • Source:  animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  LD50 ;198 +- 33 pmol/g
  • Taxonomy:  Eratigena (genus), Agelenidae (family), RTA clade, Entelegynae, Araneomorphae (suborder), Araneae (order), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQK
  • Length:  50
  • Propeptide:  MKLQLMICLVLLPCFFCEPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQKG
  • Signal peptide:  MKLQLMICLVLLPCFFC
  • Modification:  T50 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Toxin that paralyzes insects. May have a direct effect on the insect central nervous system.
  • Mechanism:  Arose via modification of ancestral neuropeptide hormones (ion transport peptide/crustacean hyperglycemic hormones (ITP/CHH)).
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-36; 22-32; 25-45
  • Structure ID:  AF-O46166-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005492_AF2.pdbhor005492_ESM.pdb

Physical Information

Mass: 656050 Formula: C234H360N72O80S7
Absent amino acids: LW Common amino acids: ACE
pI: 4.94 Basic residues: 8
Polar residues: 17 Hydrophobic residues: 12
Hydrophobicity: -81.8 Boman Index: -13844
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 37.2
Instability Index: 4778.8 Extinction Coefficient cystines: 3355
Absorbance 280nm: 68.47

Literature

  • PubMed ID:  9589602
  • Title:  Novel insecticidal peptides from Tegenaria agrestis spider venom may have a direct effect on the insect central nervous system.
  • PubMed ID:  26073605
  • Title:  Weaponization of a hormone: convergent recruitment of hyperglycemic hormone into the venom of arthropod predators.