General Information

  • ID:  hor005489
  • Uniprot ID:  P01300
  • Protein name:  Pancreatic icosapeptide
  • Gene name:  PPY
  • Organism:  Sus scrofa (Pig)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Induced in hypoglycemia, and, in vitro, by carbocal, in fetal pancreatic cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DEEDLLDLKCSSLHAAAPR
  • Length:  19(40-58)
  • Propeptide:  APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRYGKRDEEDLLDLKCSSLHAAAPRELSPMGA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induced in hypoglycemia
  • Mechanism:  May be used as a marker of the viability of xenotransplanted fetal panreatic tissue in the immediate post-transplant period.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01300-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005489_AF2.pdbhor005489_ESM.pdb

Physical Information

Mass: 240457 Formula: C87H143N25O32S
Absent amino acids: FGIMNQTVWY Common amino acids: L
pI: 4.23 Basic residues: 3
Polar residues: 3 Hydrophobic residues: 7
Hydrophobicity: -48.42 Boman Index: -4532
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 97.89
Instability Index: 4860.53 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11564690
  • Title:  Secretion of pancreatic icosapeptide from porcine pancreas.