General Information

  • ID:  hor005488
  • Uniprot ID:  P01300
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Sus scrofa (Pig)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Induced in hypoglycemia, and, in vitro, by carbocal, in fetal pancreatic cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY
  • Length:  36(1-36)
  • Propeptide:  APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRYGKRDEEDLLDLKCSSLHAAAPRELSPMGA
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  May be used as a marker of the viability of xenotransplanted fetal panreatic tissue in the immediate post-transplant period.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01300-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005488_AF2.pdbhor005488_ESM.pdb

Physical Information

Mass: 482222 Formula: C186H287N51O56S2
Absent amino acids: CFHKSW Common amino acids: AP
pI: 4.67 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 10
Hydrophobicity: -78.06 Boman Index: -8256
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.28
Instability Index: 6552.22 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  NA
  • Title:  NA