General Information

  • ID:  hor005487
  • Uniprot ID:  P80045
  • Protein name:  Ovary maturating parsin
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  YYEAPPDGRHLLLQPAPAAPAVAPAAPASWPHQQRRQALDEFAAAAAAAADAQFQDEEEDGGRRV
  • Length:  65(1-65)
  • Propeptide:  YYEAPPDGRHLLLQPAPAAPAVAPAAPASWPHQQRRQALDEFAAAAAAAADAQFQDEEEDGGRRV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neurohormone that anticipates ovarian maturation. Acts as a true gonadotropin and stimulates vitellogenin biosynthesis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80045-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P80045-F1.pdbhor005487_AF2.pdbhor005487_ESM.pdb

Physical Information

Mass: 804833 Formula: C304H457N91O95
Absent amino acids: CIKMNT Common amino acids: A
pI: 4.4 Basic residues: 7
Polar residues: 6 Hydrophobic residues: 28
Hydrophobicity: -61.23 Boman Index: -12523
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 62.15
Instability Index: 9190 Extinction Coefficient cystines: 8480
Absorbance 280nm: 132.5

Literature

  • PubMed ID:  1765072
  • Title:  Physical characterization and sequence identification of the ovary maturating parsin. A new neurohormone purified from the nervous corpora cardiaca of the African locust (Locusta migratoria migratorioides.