General Information

  • ID:  hor005481
  • Uniprot ID:  P55319
  • Protein name:  Adipokinetic hormone precursor-related peptide alpha chain
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DAADFADPYSFLYRLIQAEARKMSGCSN
  • Length:  28(36-63)
  • Propeptide:  MVQRCALVVLLVVAVAAALCSAQLNFTPNWGTGKRDAADFADPYSFLYRLIQAEARKMSGCSN
  • Signal peptide:  MVQRCALVVLLVVAVAAALCSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone, released from cells in the corpora cardiaca, causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  26-26
  • Structure ID:  AF-P55319-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005481_AF2.pdbhor005481_ESM.pdb

Physical Information

Mass: 362228 Formula: C137H207N37O44S2
Absent amino acids: HTVW Common amino acids: A
pI: 4.5 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 10
Hydrophobicity: -35 Boman Index: -5668
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 59.64
Instability Index: 2218.21 Extinction Coefficient cystines: 2980
Absorbance 280nm: 110.37

Literature

  • PubMed ID:  2731552
  • Title:  Isolation and structure of two novel 6-kDa dimeric peptides from the corpora cardiaca of the insect Locusta migratoria. Molecular mass determination by mass spectrometry.