General Information

  • ID:  hor005475
  • Uniprot ID:  P09687
  • Protein name:  Glucagon-33
  • Gene name:  gcg
  • Organism:  Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Scyliorhinus (genus), Scyliorhinidae (family), Carcharhiniformes (order), Galeoidea (superorder), Galeomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSEGTFTSDYSKYMDNRRAKDFVQWLMSTKRNG
  • Length:  33(1-33)
  • Propeptide:  HSEGTFTSDYSKYMDNRRAKDFVQWLMSTKRNGHAEGTYTSDVDSLSDYFKAKRFVDSLKSY
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09687-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005475_AF2.pdbhor005475_ESM.pdb

Physical Information

Mass: 452830 Formula: C171H259N51O54S2
Absent amino acids: CIP Common amino acids: S
pI: 9.86 Basic residues: 7
Polar residues: 13 Hydrophobic residues: 6
Hydrophobicity: -131.21 Boman Index: -11381
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 23.64
Instability Index: 7120.61 Extinction Coefficient cystines: 8480
Absorbance 280nm: 265

Literature

  • PubMed ID:  8015974
  • Title:  Primary structures of peptides derived from proglucagon isolated from the pancreas of the elasmobranch fish, Scyliorhinus canicula