General Information

  • ID:  hor005474
  • Uniprot ID:  Q9DFD6
  • Protein name:  Hepcidin
  • Gene name:  hamp
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Hepcidin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0006879 intracellular iron ion homeostasis; GO:0007165 signal transduction; GO:0008285 negative regulation of cell population proliferation; GO:0042742 defense response to bacterium
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  XSHLSLCRWCCNCCHNKGXGFCCKF
  • Length:  25
  • Propeptide:  LQVLTEEVGSIDSPVGEHQQPGGESMRLPEHFRFKRXSHLSLCRWCCNCCHNKGXGFCCKF
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. May also have antimicrobial activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-23; 10-13; 11-19; 14-22
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005474_AF2.pdbhor005474_ESM.pdb

Physical Information

Mass: 326241 Formula: C110H161N35O26S7
Absent amino acids: ADEIMPQTVY Common amino acids: C
pI: 8.3 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 5
Hydrophobicity: 6.8 Boman Index: -2645
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index 31.2
Instability Index: 5874.8 Extinction Coefficient cystines: 5875
Absorbance 280nm: 244.79

Literature

  • PubMed ID:  11164886
  • Title:  Immune-relevant (including acute phase) genes identified in the livers of rainbow trout, Oncorhynchus mykiss, by means of suppression subtractive hybridization.