General Information

  • ID:  hor005473
  • Uniprot ID:  P08379
  • Protein name:  Adipokinetic hormone 2
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLNFSAGW
  • Length:  8(23-30)
  • Propeptide:  MTQSCTLTLVLVVAVLAALATAQLNFSAGWGRRYADPNADPMAFLYRLIQIEARKLAGCSD
  • Signal peptide:  MTQSCTLTLVLVVAVLAALATA
  • Modification:  T1 Pyrrolidone carboxylic acid;T8 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P08379-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005473_AF2.pdbhor005473_ESM.pdb

Physical Information

Mass: 104705 Formula: C43H59N11O12
Absent amino acids: CDEHIKMPRTVY Common amino acids: AFGLNQSW
pI: 6.11 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -8.75 Boman Index: -260
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 61.25
Instability Index: 538.75 Extinction Coefficient cystines: 5500
Absorbance 280nm: 785.71

Literature

  • PubMed ID:  4063072
  • Title:  Primary structures of locust adipokinetic hormones II.
  • PubMed ID:  3947348
  • Title:  Sequence analyses of adipokinetic hormones II from corpora cardiaca of Schistocerca nitans, Schistocerca gregaria, and Locusta migratoria by fast atom bombardment mass spectrometry.
  • PubMed ID:  2731552
  • Title:  Isolation and st