General Information

  • ID:  hor005457
  • Uniprot ID:  P67807
  • Protein name:  Accessory gland-specific peptide 70A
  • Gene name:  Acp70A
  • Organism:  Drosophila simulans (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  Main cells of the accessory glands of males (paragonial gland).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007610 behavior; GO:0046008 regulation of female receptivity, post-mating
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC
  • Length:  55(1-55)
  • Propeptide:  MKTLSLFLVLVCLLGLVQSWEWPWNRKPTKYPIPSPNPRDKWCRLNLGPAWGGRC
  • Signal peptide:  MKTLSLFLVLVCLLGLVQS
  • Modification:  T28 Hydroxyproline;T32 Hydroxyproline;T34 Hydroxyproline;T38 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Represses female sexual receptivity and stimulates oviposition.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  43-55
  • Structure ID:  AF-P67807-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P67807-F1.pdbhor005457_AF2.pdbhor005457_ESM.pdb

Physical Information

Mass: 738704 Formula: C299H460N80O70S4
Absent amino acids: H Common amino acids: L
pI: 10.48 Basic residues: 8
Polar residues: 16 Hydrophobic residues: 20
Hydrophobicity: -21.27 Boman Index: -5064
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.55
Instability Index: 3255.82 Extinction Coefficient cystines: 29115
Absorbance 280nm: 539.17

Literature

  • PubMed ID:  9286679
  • Title:  Evolutionary history of the sex-peptide (Acp70A) gene region in Drosophila melanogaster.
  • PubMed ID:  17994087
  • Title:  Evolution of genes and genomes on the Drosophila phylogeny.
  • PubMed ID:  14762063
  • Title:   Patterns of evolutionary constraints in intronic and intergenic DNA of Drosophila.