General Information

  • ID:  hor005451
  • Uniprot ID:  P81160
  • Protein name:  Ductus ejaculatorius peptide 99B
  • Gene name:  Dup99B
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  Ductus ejaculatorius.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007610 behavior; GO:0007621 negative regulation of female receptivity; GO:0018991 egg-laying behavior; GO:0019953 sexual reproduction; GO:0045434 negative regulation of female receptivity, post-mating; GO:0046008 regulation of female receptivity, post-mating; GO:0046662 regulation of egg-laying behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QDRNDTEWIQSQKDREKWCRLNLGPYLGGRC
  • Length:  31(22-52)
  • Propeptide:  MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGGRCRK
  • Signal peptide:  MKTPLFLLLVVLASLLGLALS
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  T4 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  Induces post-mating responses; increased oviposition and reduced receptivity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  19-31
  • Structure ID:  AF-P81160-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005451_AF2.pdbhor005451_ESM.pdb

Physical Information

Mass: 430148 Formula: C160H250N52O50S2
Absent amino acids: AFHMV Common amino acids: R
pI: 8.22 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 6
Hydrophobicity: -152.58 Boman Index: -11685
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 50.32
Instability Index: 3589.03 Extinction Coefficient cystines: 12615
Absorbance 280nm: 420.5

Literature

  • PubMed ID:  11846801
  • Title:  Ductus ejaculatorius peptide 99B (DUP99B), a novel Drosophila melanogaster sex-peptide pheromone.