General Information

  • ID:  hor005449
  • Uniprot ID:  P11184
  • Protein name:  Relaxin B chain
  • Gene name:  NA
  • Organism:  Balaenoptera acutorostrata (Common minke whale) (Balaena rostrata)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Balaenoptera (genus), Balaenopteridae (family), Mysticeti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QSTNDLIKACGRELVRLWVEICGSVRWGQSAL
  • Length:  32(1-32)
  • Propeptide:  QSTNDLIKACGRELVRLWVEICGSVRWGQSALRMTLSEKCCQVGCIRKDIARLC
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts with estrogen to produce dilatation of the birth canal in many mammals
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11184-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005449_AF2.pdbhor005449_ESM.pdb

Physical Information

Mass: 414229 Formula: C156H255N47O46S2
Absent amino acids: FHMPY Common amino acids: L
pI: 8.23 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 13
Hydrophobicity: 2.81 Boman Index: -4784
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 106.56
Instability Index: 6895.63 Extinction Coefficient cystines: 11125
Absorbance 280nm: 358.87

Literature

  • PubMed ID:  2910872
  • Title:  Cetacean relaxin. Isolation and sequence of relaxins from Balaenoptera acutorostrata and Balaenoptera edeni.