General Information

  • ID:  hor005448
  • Uniprot ID:  P11953
  • Protein name:  Relaxin A chain
  • Gene name:  NA
  • Organism:  Squalus acanthias (Spiny dogfish)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Squalus (genus), Squalidae (family), Squaliformes (order), Squalomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EGSPGMSSKCCTYGCTRKDISILC
  • Length:  24(31-54)
  • Propeptide:  QSFKNAEPGIKLCGREFIRAVIYTCGGSRWEGSPGMSSKCCTYGCTRKDISILC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The function of relaxin in an oviparous species is not yet known.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-P11953-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005448_AF2.pdbhor005448_ESM.pdb

Physical Information

Mass: 295038 Formula: C102H171N29O36S5
Absent amino acids: AFHNQVW Common amino acids: CS
pI: 7.91 Basic residues: 3
Polar residues: 14 Hydrophobic residues: 3
Hydrophobicity: -13.75 Boman Index: -3538
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 8587.92 Extinction Coefficient cystines: 1740
Absorbance 280nm: 75.65

Literature

  • PubMed ID:  3780747
  • Title:  Isolation, purification, and the sequence of relaxin from spiny dogfish (Squalus acanthias)