General Information

  • ID:  hor005435
  • Uniprot ID:  C0HJI8
  • Protein name:  Insulin-2 B chain
  • Gene name:  NA
  • Organism:  Huso dauricus (Kaluga sturgeon) (Acipenser dauricus)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Huso (genus), Husinae (subfamily), Acipenseridae (family), Acipenseroidei (suborder), Acipenseriformes (order), Chondrostei (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AANQHLCGAHLVEALYLVCGERGFFYTPNKV
  • Length:  31(1-31)
  • Propeptide:  AANQHLCGAHLVEALYLVCGERGFFYTPNKVGIVEQCCHSPCSLYDLENYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HJI8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005435_AF2.pdbhor005435_ESM.pdb

Physical Information

Mass: 395725 Formula: C155H234N42O42S2
Absent amino acids: DIMSW Common amino acids: AL
pI: 7.42 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 13
Hydrophobicity: 23.23 Boman Index: -1470
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 91.29
Instability Index: 927.42 Extinction Coefficient cystines: 3105
Absorbance 280nm: 103.5

Literature

  • PubMed ID:  11150638
  • Title:  Multiple molecular forms of glucagon and insulin in the kaluga sturgeon, Huso dauricus.