General Information

  • ID:  hor005412
  • Uniprot ID:  P01336
  • Protein name:  Insulin A chain
  • Gene name:  ins
  • Organism:  Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gadus morhua (species), Gadus (genus), Gadidae (family), Gadoidei (suborder), Gadiformes (order), Gadariae, Zeiogadaria, Paracanthopterygii, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GIVDQCCHRPCDIFDLQNYCN
  • Length:  21(31-51)
  • Propeptide:  MAPPQHLCGSHLVDALYLVCGDRGFFYNPKGIVDQCCHRPCDIFDLQNYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  AF-P01336-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005412_AF2.pdbhor005412_ESM.pdb

Physical Information

Mass: 281372 Formula: C102H154N30O33S4
Absent amino acids: AEKMSTW Common amino acids: C
pI: 4.31 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 5
Hydrophobicity: -27.14 Boman Index: -4240
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 69.52
Instability Index: 4236.67 Extinction Coefficient cystines: 1740
Absorbance 280nm: 87

Literature

  • PubMed ID:  4881974
  • Title:  The sequence of amino acids in insulin isolated from islet tissue of the cod (Gadus callarias).
  • PubMed ID:  4866431
  • Title:  Isolation and a partial amino acid sequence of insulin from the islet tissue of cod (Gadus callarias).