General Information

  • ID:  hor005399
  • Uniprot ID:  P01331
  • Protein name:  Insulin B chain
  • Gene name:  INS
  • Organism:  Proechimys guairae (Guaira spiny rat)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Proechimys (genus), Echimyidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YVGQRLCGSQLVDTLYSVCKHRGFYRPSE
  • Length:  29(1-29)
  • Propeptide:  YVGQRLCGSQLVDTLYSVCKHRGFYRPSEGIVDQCCTNICSRNQLLTYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01331-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005399_AF2.pdbhor005399_ESM.pdb

Physical Information

Mass: 386243 Formula: C148H229N43O43S2
Absent amino acids: AIMNW Common amino acids: GLRSVY
pI: 8.75 Basic residues: 5
Polar residues: 12 Hydrophobic residues: 7
Hydrophobicity: -43.45 Boman Index: -5953
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 70.34
Instability Index: 2541.03 Extinction Coefficient cystines: 4595
Absorbance 280nm: 164.11

Literature

  • PubMed ID:  16068186
  • Title:  Evolutionary change in the insulin receptors of hystricomorph rodents.