General Information

  • ID:  hor005398
  • Uniprot ID:  P01340
  • Protein name:  Insulin A chain
  • Gene name:  ins
  • Organism:  Katsuwonus pelamis (Skipjack tuna) (Bonito)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Katsuwonus (genus), Thunnini (tribe), Scombrinae (subfamily), Scombridae (family), Scombriformes (order), Pelagiaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GIHZZCCHKPCBIFZLZBYCN
  • Length:  21(30-50)
  • Propeptide:  AANPHLCGSHLVEALYLVCGERGFFYQPKGIHZZCCHKPCBIFZLZBYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005398_AF2.pdbhor005398_ESM.pdb

Physical Information

Mass: 199997 Formula: C77H103N21O12S4
Absent amino acids: ADEMQRSTVW Common amino acids: C
pI: 7.95 Basic residues: 3
Polar residues: 7 Hydrophobic residues: 4
Hydrophobicity: 40.48 Boman Index: 215
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 2621.43 Extinction Coefficient cystines: 1740
Absorbance 280nm: 87

Literature

  • PubMed ID:  14035061
  • Title:  Studies on insulin. V. On the structure of the glycyl chain of bonito insulin II.
  • PubMed ID:  14036898
  • Title:  Studies on insulin. III. On the structure of the alanyl chain of bonito insulin.