General Information

  • ID:  hor005375
  • Uniprot ID:  P23465
  • Protein name:  Diuretic hormone
  • Gene name:  NA
  • Organism:  Locusta migratoria (Migratory locust)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Locusta (genus), Oedipodinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MGMGPSLSIVNPMDVLRQRLLLEIARRRLRDAEEQIKANKDFLQQI
  • Length:  46(1-46)
  • Propeptide:  MGMGPSLSIVNPMDVLRQRLLLEIARRRLRDAEEQIKANKDFLQQI
  • Signal peptide:  NA
  • Modification:  T46 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P23465-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P23465-F1.pdbhor005375_AF2.pdbhor005375_ESM.pdb

Physical Information

Mass: 616720 Formula: C232H398N72O67S3
Absent amino acids: CHTWY Common amino acids: L
pI: 10.72 Basic residues: 8
Polar residues: 6 Hydrophobic residues: 17
Hydrophobicity: -33.7 Boman Index: -10991
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 112.39
Instability Index: 7572.17 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1654896
  • Title:  Identification of a diuretic hormone of Locusta migratoria.
  • PubMed ID:  1663363
  • Title:   Characterization of a diuretic peptide from Locusta migratoria.