General Information

  • ID:  hor005372
  • Uniprot ID:  P01349
  • Protein name:  Relaxin A chain
  • Gene name:  NA
  • Organism:  Carcharias taurus (Sand tiger shark) (Eugomphodus taurus)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carcharias (genus), Odontaspididae (family), Lamniformes (order), Galeoidea (superorder), Galeomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ATSPAMSIKCCIYGCTKKDISVLC
  • Length:  24(21-44)
  • Propeptide:  QLCGRGFIRAIIFACGGSRWATSPAMSIKCCIYGCTKKDISVLC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-P01349-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005372_AF2.pdbhor005372_ESM.pdb

Physical Information

Mass: 294654 Formula: C107H183N27O33S5
Absent amino acids: EFHNQRW Common amino acids: C
pI: 8.33 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: 61.25 Boman Index: -510
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 85.42
Instability Index: 6073.33 Extinction Coefficient cystines: 1740
Absorbance 280nm: 75.65

Literature

  • PubMed ID:  7274472
  • Title:  On the primary and tertiary structure of relaxin from the sand tiger shark (Odontaspis taurus).
  • PubMed ID:  3780747
  • Title:   Isolation, purification, and the sequence of relaxin from spiny dogfish (Squalus acanthias).