General Information

  • ID:  hor005367
  • Uniprot ID:  P01281
  • Protein name:  Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide)
  • Gene name:  GIP
  • Organism:  Sus scrofa (Pig)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0009749 response to glucose; GO:0038192 gastric inhibitory peptide signaling pathway; GO:0042304 regulation of fatty acid biosynthetic process; GO:0050796 regulation of insulin secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
  • Length:  42(1-42)
  • Propeptide:  YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01281-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01281-F1.pdbhor005367_AF2.pdbhor005367_ESM.pdb

Physical Information

Mass: 570713 Formula: C225H342N60O66S
Absent amino acids: CP Common amino acids: K
pI: 9.06 Basic residues: 7
Polar residues: 11 Hydrophobic residues: 14
Hydrophobicity: -76.19 Boman Index: -8624
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 69.76
Instability Index: 3496.67 Extinction Coefficient cystines: 13980
Absorbance 280nm: 340.98

Literature

  • PubMed ID:  7227513
  • Title:  Amino Acid Sequence and Heterogeneity of Gastric Inhibitory Polypeptide (GIP)
  • PubMed ID:  8375398
  • Title:  Isolation of Three Antibacterial Peptides From Pig Intestine: Gastric Inhibitory Polypeptide (7-42), Diazepam-Binding Inhibitor (32-86) and a Novel Factor, Peptide 3910