General Information

  • ID:  hor005342
  • Uniprot ID:  P41321
  • Protein name:  Neuropeptide F
  • Gene name:  NA
  • Organism:  Cornu aspersum (Brown garden snail) (Helix aspersa)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Neuronal somata and fibers.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cornu (subgenus), Cornu (genus), Helicidae (family), Helicoidea (superfamily), Helicina, Stylommatophora (order), Eupulmonata (superorder), Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  STQMLSPPERPREFRHPNELRQYLKELNEYYAIMGRTRF
  • Length:  39(1-39)
  • Propeptide:  STQMLSPPERPREFRHPNELRQYLKELNEYYAIMGRTRF
  • Signal peptide:  NA
  • Modification:  T39 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have an important physiological role in neuroregulation.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41321-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P41321-F1.pdbhor005342_AF2.pdbhor005342_ESM.pdb

Physical Information

Mass: 553346 Formula: C215H334N64O61S2
Absent amino acids: CDVW Common amino acids: R
pI: 9.78 Basic residues: 8
Polar residues: 10 Hydrophobic residues: 8
Hydrophobicity: -124.1 Boman Index: -13249
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 52.56
Instability Index: 5067.95 Extinction Coefficient cystines: 4470
Absorbance 280nm: 117.63

Literature

  • PubMed ID:  1472263
  • Title:  The primary structure of neuropeptide F (NPF) from the garden snail, Helix aspersa.