General Information

  • ID:  hor005341
  • Uniprot ID:  P01197
  • Protein name:  Corticotropin
  • Gene name:  pomc
  • Organism:  Squalus acanthias (Spiny dogfish)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Squalus (genus), Squalidae (family), Squaliformes (order), Squalomorphii, Selachii (infraclass), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPMGRKRRPIKVYPNSFEDESVENMGPEL
  • Length:  39
  • Propeptide:  SYSMEHFRWGKPMGRKRRPIKVYPNSFEDESVENMGPEL
  • Signal peptide:  NA
  • Modification:  T13 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01197-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P01197-F1.pdbhor005341_AF2.pdbhor005341_ESM.pdb

Physical Information

Mass: 536424 Formula: C207H315N59O60S3
Absent amino acids: ACQT Common amino acids: E
pI: 9.1 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -121.03 Boman Index: -11484
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 34.87
Instability Index: 5010 Extinction Coefficient cystines: 8480
Absorbance 280nm: 223.16

Literature

  • PubMed ID:  4375977
  • Title:  The isolation and amino acid sequence of an adrenocorticotrophin from the pars distalis and a corticotrophin-like intermediate-lobe peptide from the neurointermediate lobe of the pituitary of the dogfish Squalus acanthias.