General Information

  • ID:  hor005331
  • Uniprot ID:  P81039
  • Protein name:  Pituitary adenylate cyclase-activating polypeptide
  • Gene name:  NA
  • Organism:  Uranoscopus japonicus (Japanese stargazer)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Uranoscopus (genus), Uranoscopidae (family), Uranoscopiformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDGIFTDSYSRYRKQMAVQKYLAAVLGRRYRQRVRNK
  • Length:  38(1-38)
  • Propeptide:  HSDGIFTDSYSRYRKQMAVQKYLAAVLGRRYRQRVRNK
  • Signal peptide:  NA
  • Modification:  T38 Lysine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator.; Stimulates adenylate cyclase in pituitary cells.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81039-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P81039-F1.pdbhor005331_AF2.pdbhor005331_ESM.pdb

Physical Information

Mass: 527942 Formula: C202H326N68O55S
Absent amino acids: CEPW Common amino acids: R
pI: 11.51 Basic residues: 11
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -109.74 Boman Index: -14026
Half-Life / Aliphatic Index: 3.5 hour Aliphatic Index: 61.58
Instability Index: 4387.11 Extinction Coefficient cystines: 5960
Absorbance 280nm: 161.08

Literature

  • PubMed ID:  9213367
  • Title:  Isolation and structural characterization of pituitary adenylate cyclase activating polypeptide (PACAP)-like peptide from the brain of a teleost, stargazer, Uranoscopus japonicus.