General Information

  • ID:  hor005315
  • Uniprot ID:  P12968
  • Protein name:  Islet amyloid polypeptide
  • Gene name:  Iapp
  • Organism:  Mus musculus (Mouse)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0008289 lipid binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0008285 negative regulation of cell population proliferation; GO:0010628 positive regulation of gene expression; GO:0010739 positive regulation of protein kinase A signaling; GO:0019233 sensory perception of pain; GO:0030316 osteoclast differentiation; GO:0031648 protein destabilization; GO:0042755 eating behavior; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045453 bone resorption; GO:0045671 negative regulation of osteoclast differentiation; GO:0045779 negative regulation of bone resorption; GO:0050850 positive regulation of calcium-mediated signaling; GO:0051260 protein homooligomerization; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0070374 positive regulation of ERK1 and ERK2 cascade; GO:0097647 amylin receptor signaling pathway; GO:1990000 amyloid fibril formation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005829 cytosol; GO:0016234 inclusion body

Sequence Information

  • Sequence:  KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
  • Length:  37(38-74)
  • Propeptide:  MMCISKLPAVLLILSVALNHLRATPVRSGSNPQMDKRKCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYGKRNAAGDPNRESLDFLLV
  • Signal peptide:  MMCISKLPAVLLILSVALNHLRA
  • Modification:  T37 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Calcr
  • Target Unid:   Q60755
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-P12968-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005315_AF2.pdbhor005315_ESM.pdb

Physical Information

Mass: 456573 Formula: C167H273N51O54S2
Absent amino acids: DEHIMW Common amino acids: N
pI: 9.54 Basic residues: 3
Polar residues: 19 Hydrophobic residues: 11
Hydrophobicity: -24.86 Boman Index: -5931
Half-Life / Aliphatic Index: 1.3 hour Aliphatic Index: 73.78
Instability Index: 2538.11 Extinction Coefficient cystines: 1615
Absorbance 280nm: 44.86

Literature

  • PubMed ID:  2668946
  • Title:  Conservation of the sequence of islet amyloid polypeptide in five mammals is consistent with its putative role as an islet hormone.