General Information

  • ID:  hor005307
  • Uniprot ID:  P30881
  • Protein name:  Calcitonin gene-related peptide
  • Gene name:  CALCA
  • Organism:  Ovis aries (Sheep)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SCNTATCVTHRLAGLLSRSGGVVKSNFVPTNVGSQAF
  • Length:  37(1-37)
  • Propeptide:  SCNTATCVTHRLAGLLSRSGGVVKSNFVPTNVGSQAF
  • Signal peptide:  NA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-P30881-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P30881-F1.pdbhor005307_AF2.pdbhor005307_ESM.pdb

Physical Information

Mass: 442259 Formula: C161H264N50O51S2
Absent amino acids: DEIMWY Common amino acids: SV
pI: 9.92 Basic residues: 4
Polar residues: 18 Hydrophobic residues: 13
Hydrophobicity: 22.43 Boman Index: -4012
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 78.92
Instability Index: 3154.32 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  1417824
  • Title:  Identification of calcitonin gene related peptide in ovine hypothalamic extract.