General Information

  • ID:  hor005302
  • Uniprot ID:  P09641
  • Protein name:  Peptide YY-like
  • Gene name:  NA
  • Organism:  Myoxocephalus scorpius (Shorthorn sculpin) (Cottus scorpius)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Myoxocephalus (genus), Cottidae (family), Cottales (infraorder), Cottioidei (suborder), Perciformes (order), Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRY
  • Length:  36(1-36)
  • Propeptide:  YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09641-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P09641-F1.pdbhor005302_AF2.pdbhor005302_ESM.pdb

Physical Information

Mass: 479404 Formula: C188H275N55O54
Absent amino acids: CFM Common amino acids: P
pI: 8.98 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -115.56 Boman Index: -8689
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 48.89
Instability Index: 9510 Extinction Coefficient cystines: 11460
Absorbance 280nm: 327.43

Literature

  • PubMed ID:  2883025
  • Title:  The amino-acid sequences of sculpin islet somatostatin-28 and peptide YY.
  • PubMed ID:  3562898
  • Title:  Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).