General Information

  • ID:  hor005296
  • Uniprot ID:  P68005
  • Protein name:  Peptide YY (PYY) (Peptide tyrosine tyrosine)
  • Gene name:  PYY
  • Organism:  Sus scrofa (Pig)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
  • Length:  36(1-36)
  • Propeptide:  YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
  • Signal peptide:  NA
  • Modification:  T13 Phosphoserine;T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P68005-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P68005-F1.pdbhor005296_AF2.pdbhor005296_ESM.pdb

Physical Information

Mass: 486613 Formula: C190H287N53O58
Absent amino acids: CFIMW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -109.44 Boman Index: -9960
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 62.5
Instability Index: 9299.17 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  6953409
  • Title:  Isolation and characterization of peptide YY (PYY), a candidate gut hormone that inhibits pancreatic exocrine secretion.